PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 564aa    MW: 63997.4 Da    PI: 7.2277
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008130.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.11.2e-881845494374
         GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl.fsevsPilkfshltaN 99 
                  lLl+ Ae v ++++ +a++lL+r +  as++ +p+qR++  f+eAL++r+++ ++  + k ++ +++ e+ +  +++  +l +++  Pi ++ +lta 
  CCG008130.1 184 LLLATAEKVGDQQFDRASRLLSRCEMVASERSNPLQRVVYSFAEALQERIHKaTGRFIPKEMKGKPNCETPHGLSTHLAHLsLHQNVPINQVMQLTAI 281
                  899*************************************************77778888887777766554444444444499************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaI e v +++++H iD++i  G+QW aL+qaLa+R++   +l+iT+vg       +++eetg+rL+ fA+ ++ pf f+++ ++ +++++ e +++ 
  CCG008130.1 282 QAIIENVGSARKIHLIDLEIRSGVQWTALMQALADRQRRLDHLKITAVGL---RGIQKIEETGKRLEIFARYMNFPFTFKPIQVSCMSEIKEELFETA 376
                  *************************************************9...5799***************************************** PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                   +Ea++V   + l ++l+++++le+    +++++k+l+P +++v e ea+hns++F++rf+eal +ysa fd+l++ l +++e+r+  E+  +++ i+
  CCG008130.1 377 ADEAIVVVANMILRTMLSRPACLEN----LMRVIKNLNPSIMIVGEVEANHNSPTFVNRFIEALFFYSAYFDCLDTCLKQNTEHRTITEAT-FSNGIE 469
                  ***********************99....*************************************************8888888888888.****** PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  n+v++eg++r++r  ++  Wr+ ++++ + +v ++++   qa l+ ++++ +   ++e++ ++l+lgWk+ pL s+SaW+
  CCG008130.1 470 NIVTMEGTDRIARSVKMDVWRAFFSRFRMVEVGFGDSSLYQAGLIPKQFPcGSLCTIEKNGKCLILGWKGTPLHSLSAWK 549
                  **************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.254155528IPR005202Transcription factor GRAS
PfamPF035144.2E-86184549IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MIEGEKGRLF SMEDLGQVYP LCSEYCSYQD NTENKGLNFF RDQQQPQQQQ SPSKSSYLTL  60
DDFLGSCFPA PAQPMQEIKR LESIAKNSKE TLYTPALSSS LQLLRKYGSG KEIECNQLGG  120
ASDETCFSTR KKLSTEEIIR VAGSSFIQFS DQRYDDFFML MHPVGYALSG LSEEETRDVE  180
LTLLLLATAE KVGDQQFDRA SRLLSRCEMV ASERSNPLQR VVYSFAEALQ ERIHKATGRF  240
IPKEMKGKPN CETPHGLSTH LAHLSLHQNV PINQVMQLTA IQAIIENVGS ARKIHLIDLE  300
IRSGVQWTAL MQALADRQRR LDHLKITAVG LRGIQKIEET GKRLEIFARY MNFPFTFKPI  360
QVSCMSEIKE ELFETAADEA IVVVANMILR TMLSRPACLE NLMRVIKNLN PSIMIVGEVE  420
ANHNSPTFVN RFIEALFFYS AYFDCLDTCL KQNTEHRTIT EATFSNGIEN IVTMEGTDRI  480
ARSVKMDVWR AFFSRFRMVE VGFGDSSLYQ AGLIPKQFPC GSLCTIEKNG KCLILGWKGT  540
PLHSLSAWKF SRERLWSSLA NYKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3620454926375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302767.10.0hypothetical protein POPTR_0002s19660g
TrEMBLB9GST20.0B9GST2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s19660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-56RGA-like 2